PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G157500.1.p
Common NameSb09g022060, SORBIDRAFT_09g022060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 326aa    MW: 35136.1 Da    PI: 6.9336
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G157500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.24.3e-093680244
                          SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
       Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                          g+WT eE + + +a ++  ++   +W+++a+ ++ gRt  +++ ++
  Sobic.009G157500.1.p 36 GAWTVEENKMFERALARVDSDapdRWERVAQLLP-GRTVADVVAHY 80
                          89********************************.*********99 PP

2Myb_DNA-binding44.92.7e-14152196347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           +WT+eE++l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
  Sobic.009G157500.1.p 152 PWTEEEHKLFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 196
                           7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.7483084IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-43381IPR009057Homeodomain-like
SMARTSM007174.5E-73486IPR001005SANT/Myb domain
PfamPF002497.7E-83580IPR001005SANT/Myb domain
SuperFamilySSF466895.46E-103687IPR009057Homeodomain-like
CDDcd001675.69E-73780No hitNo description
PROSITE profilePS5129416.847144201IPR017930Myb domain
SuperFamilySSF466891.51E-17147201IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-17148199IPR006447Myb domain, plants
SMARTSM007175.3E-12149199IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-12150195IPR009057Homeodomain-like
PfamPF002491.4E-11152196IPR001005SANT/Myb domain
CDDcd001672.33E-11152197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MTELWMEVLP PPYFAGQAAG GGWFLPPPPD RRAGTGAWTV EENKMFERAL ARVDSDAPDR  60
WERVAQLLPG RTVADVVAHY DDLESDVGFI EAGFVPFPRY GGGGGGASQS AGFTFDWDAG  120
AGDAGFKRSC YVVGGGKRER GGPDQERKKG IPWTEEEHKL FLMGLKKYGR GDWRNISRNF  180
VTSRTPTQVA SHAQKYFIRL NSGGKDKRRS SIHDITTVNL PDDDTAGGGN PSASPPSVSV  240
LTSTSTTPSS TTTGGGPVIS EQFGVLVDSK PPPPHHHHHH HFLPHSSYGN VKLEPGVNSH  300
HGAGFLDDSV LMQMQMHCGQ LQPLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1732105578RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.130910.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542810.0BT054281.1 Zea mays full-length cDNA clone ZM_BFb0211P03 mRNA, complete cds.
GenBankBT0558020.0BT055802.1 Zea mays full-length cDNA clone ZM_BFb0203M07 mRNA, complete cds.
GenBankBT0666720.0BT066672.1 Zea mays full-length cDNA clone ZM_BFb0049J12 mRNA, complete cds.
GenBankHQ8587850.0HQ858785.1 Zea mays clone UT1771 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441197.10.0hypothetical protein SORBIDRAFT_09g022060
SwissprotQ8S9H71e-83DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLC5YYV40.0C5YYV4_SORBI; Putative uncharacterized protein Sb09g022060
STRINGSb09g022060.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.13e-79Homeodomain-like transcriptional regulator